Product Added to your Cart
x

-------- OR --------

English
FranceGermany
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
RH Powdered Stims
2 product(s) found for "RH Powdered Stims"
Rod Hutchinson Legend Hydrol..
Legend Range
Rod Hutchinson Legend Hydrol..
Description Built on years of experience our Rod Hutchinson Legend Range of Powdered Additives are the highest quality you would expect to find from the Rod Hutchinson brand. The Fine Hydrolysed Meat Meal...
£17.99
Units in Stock: 2
£17.99
Details
Add To Cart
Description Built on years of experience our Rod Hutchinson Legend Range of Powdered Additives are the highest quality you would expect to find from the Rod Hutchinson brand. The Fine Hydrolysed Meat Meal...
Rod Hutchinson Legend Savour..
RH Powdered Stims
Rod Hutchinson Legend Savour..
Description Built on years of experience our Rod Hutchinson Legend Range of Powdered Additives are the highest quality you would expect to find from the Rod Hutchinson brand. Rod Hutchinson powder additives...
£17.95
Units in Stock: 1
£17.95
Details
Add To Cart
Description Built on years of experience our Rod Hutchinson Legend Range of Powdered Additives are the highest quality you would expect to find from the Rod Hutchinson brand. Rod Hutchinson powder additives...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i